Lineage for d2vaua_ (2vau A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2424882Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2424883Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins)
    common fold is rather distorted
  6. 2424960Protein automated matches [190217] (4 species)
    not a true protein
  7. 2424963Species Emericella nidulans [TaxId:162425] [186976] (12 PDB entries)
  8. 2424972Domain d2vaua_: 2vau A: [152843]
    automated match to d1bk0a_
    complexed with fe2, v20

Details for d2vaua_

PDB Entry: 2vau (more details), 1.8 Å

PDB Description: isopenicillin n synthase with substrate analogue acomp (unexposed)
PDB Compounds: (A:) isopenicillin n synthetase

SCOPe Domain Sequences for d2vaua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vaua_ b.82.2.1 (A:) automated matches {Emericella nidulans [TaxId: 162425]}
svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
ngksdreplsygdylqnglvslinkngqt

SCOPe Domain Coordinates for d2vaua_:

Click to download the PDB-style file with coordinates for d2vaua_.
(The format of our PDB-style files is described here.)

Timeline for d2vaua_: