Lineage for d1vwtc_ (1vwt C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1254022Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1254142Species Human (Homo sapiens) [TaxId:9606] [46487] (213 PDB entries)
    Uniprot P69905 P01922 P01934 P01935
  8. 1254274Domain d1vwtc_: 1vwt C: [15283]
    Other proteins in same PDB: d1vwtb_, d1vwtd_
    complexed with hem, so4

Details for d1vwtc_

PDB Entry: 1vwt (more details), 1.9 Å

PDB Description: t state human hemoglobin [alpha v96w], alpha aquomet, beta deoxy
PDB Compounds: (C:) hemoglobin

SCOPe Domain Sequences for d1vwtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vwtc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpwnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

SCOPe Domain Coordinates for d1vwtc_:

Click to download the PDB-style file with coordinates for d1vwtc_.
(The format of our PDB-style files is described here.)

Timeline for d1vwtc_: