Lineage for d2v9je2 (2v9j E:23-181)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1645809Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 1645810Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 1645811Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 1645812Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)
  7. 1645813Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (7 PDB entries)
    Uniprot P80385 182-326! Uniprot P80385 23-181
  8. 1645821Domain d2v9je2: 2v9j E:23-181 [152808]
    Other proteins in same PDB: d2v9ja_, d2v9jb_
    automated match to d2v8qe2
    complexed with amp, atp, mg

Details for d2v9je2

PDB Entry: 2v9j (more details), 2.53 Å

PDB Description: crystal structure of the regulatory fragment of mammalian ampk in complexes with mg.atp-amp
PDB Compounds: (E:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d2v9je2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v9je2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
snssvyttfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfv
gmltitdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavs
slirnkihrlpvidpesgntlyilthkrilkflklfite

SCOPe Domain Coordinates for d2v9je2:

Click to download the PDB-style file with coordinates for d2v9je2.
(The format of our PDB-style files is described here.)

Timeline for d2v9je2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v9je1