Lineage for d2v6al1 (2v6a L:2-140)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865003Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 865004Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 865005Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 865006Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 865012Species Chlamydomonas reinhardtii [TaxId:3055] [69758] (11 PDB entries)
  8. 865020Domain d2v6al1: 2v6a L:2-140 [152711]
    Other proteins in same PDB: d2v6aa1, d2v6aa2, d2v6ab1, d2v6ab2, d2v6ac1, d2v6ac2, d2v6ad1, d2v6ad2, d2v6ae1, d2v6ae2, d2v6af1, d2v6af2, d2v6ag1, d2v6ag2, d2v6ah1, d2v6ah2
    automatically matched to d1ir21_
    complexed with cap, edo, mg, mme; mutant

Details for d2v6al1

PDB Entry: 2v6a (more details), 1.5 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with large-subunit mutations v331a, g344s
PDB Compounds: (L:) ribulose bisphosphate carboxylase small chain 1

SCOP Domain Sequences for d2v6al1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v6al1 d.73.1.1 (L:2-140) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
mvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairfg
svsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgf
lvqrpktardfqpankrsv

SCOP Domain Coordinates for d2v6al1:

Click to download the PDB-style file with coordinates for d2v6al1.
(The format of our PDB-style files is described here.)

Timeline for d2v6al1: