PDB entry 2v6a

View 2v6a on RCSB PDB site
Description: crystal structure of chlamydomonas reinhardtii rubisco with large-subunit mutations v331a, g344s
Class: oxidoreductase
Keywords: large subunit loop 6 mutation, co2/o2 specificity, carbon dioxide fixation, photosynthesis, transit peptide, photorespiration, metal-binding, hydroxylation, oxidoreductase, methylation, chloroplast, calvin cycle, monooxygenase, lyase, rubisco, plastid, magnesium, acetylation
Deposited on 2007-07-14, released 2007-07-31
The last revision prior to the SCOP 1.75 freeze date was dated 2007-10-23, with a file datestamp of 2007-10-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.17683
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
      • engineered mutation (330)
      • engineered mutation (343)
    Domains in SCOP 1.75: d2v6aa1, d2v6aa2
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
      • engineered mutation (330)
      • engineered mutation (343)
    Domains in SCOP 1.75: d2v6ab1, d2v6ab2
  • Chain 'C':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
      • engineered mutation (330)
      • engineered mutation (343)
    Domains in SCOP 1.75: d2v6ac1, d2v6ac2
  • Chain 'D':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
      • engineered mutation (330)
      • engineered mutation (343)
    Domains in SCOP 1.75: d2v6ad1, d2v6ad2
  • Chain 'E':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
      • engineered mutation (330)
      • engineered mutation (343)
    Domains in SCOP 1.75: d2v6ae1, d2v6ae2
  • Chain 'F':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
      • engineered mutation (330)
      • engineered mutation (343)
    Domains in SCOP 1.75: d2v6af1, d2v6af2
  • Chain 'G':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
      • engineered mutation (330)
      • engineered mutation (343)
    Domains in SCOP 1.75: d2v6ag1, d2v6ag2
  • Chain 'H':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
      • engineered mutation (330)
      • engineered mutation (343)
    Domains in SCOP 1.75: d2v6ah1, d2v6ah2
  • Chain 'I':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2v6ai1
  • Chain 'J':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2v6aj1
  • Chain 'K':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2v6ak1
  • Chain 'L':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2v6al1
  • Chain 'M':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2v6am1
  • Chain 'N':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2v6an1
  • Chain 'O':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2v6ao1
  • Chain 'P':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2v6ap1
  • Heterogens: MG, CAP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v6aA (A:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtavgklegerevtlsfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v6aA (A:)
    agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
    vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtce
    emmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhg
    ihfrvlakalrmsggdhlhsgtavgklegerevtlsfvdlmrddyvekdrsrgiyftqdw
    csmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleact
    qarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v6aB (B:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtavgklegerevtlsfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v6aB (B:)
    agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
    vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtce
    emmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhg
    ihfrvlakalrmsggdhlhsgtavgklegerevtlsfvdlmrddyvekdrsrgiyftqdw
    csmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleact
    qarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v6aC (C:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtavgklegerevtlsfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v6aC (C:)
    agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
    vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtce
    emmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhg
    ihfrvlakalrmsggdhlhsgtavgklegerevtlsfvdlmrddyvekdrsrgiyftqdw
    csmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleact
    qarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2v6aD (D:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtavgklegerevtlsfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v6aD (D:)
    gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv
    wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka
    lralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygrav
    yeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtcee
    mmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgi
    hfrvlakalrmsggdhlhsgtavgklegerevtlsfvdlmrddyvekdrsrgiyftqdwc
    smpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactq
    arnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2v6aE (E:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtavgklegerevtlsfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v6aE (E:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtavgklegerevtlsfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2v6aF (F:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtavgklegerevtlsfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v6aF (F:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtavgklegerevtlsfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2v6aG (G:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtavgklegerevtlsfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v6aG (G:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtavgklegerevtlsfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2v6aH (H:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtavgklegerevtlsfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v6aH (H:)
    agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
    vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtce
    emmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhg
    ihfrvlakalrmsggdhlhsgtavgklegerevtlsfvdlmrddyvekdrsrgiyftqdw
    csmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleact
    qarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v6aI (I:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v6aJ (J:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v6aK (K:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v6aL (L:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v6aM (M:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v6aN (N:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v6aO (O:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v6aP (P:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv