Lineage for d2v69d1 (2v69 D:150-474)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2447081Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2447082Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2447312Protein automated matches [226984] (16 species)
    not a true protein
  7. 2447326Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225548] (9 PDB entries)
  8. 2447386Domain d2v69d1: 2v69 D:150-474 [152674]
    Other proteins in same PDB: d2v69a2, d2v69b2, d2v69c2, d2v69d2, d2v69e2, d2v69f2, d2v69g2, d2v69h2, d2v69i_, d2v69j_, d2v69k_, d2v69l_, d2v69m_, d2v69n_, d2v69o_, d2v69p_
    automated match to d1gk8a1
    complexed with cap, edo, mg; mutant

Details for d2v69d1

PDB Entry: 2v69 (more details), 2.8 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large- subunit mutation d473e
PDB Compounds: (D:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2v69d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v69d1 c.1.14.1 (D:150-474) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfefdtiek

SCOPe Domain Coordinates for d2v69d1:

Click to download the PDB-style file with coordinates for d2v69d1.
(The format of our PDB-style files is described here.)

Timeline for d2v69d1: