Lineage for d2v49f1 (2v49 F:1-208)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825407Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 825408Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
  5. 825409Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 825410Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 825497Species Thermus thermophilus [TaxId:274] [159476] (7 PDB entries)
    Uniprot Q5SHN9 1-208
  8. 825501Domain d2v49f1: 2v49 F:1-208 [152546]
    Other proteins in same PDB: d2v4941, d2v4951, d2v4961, d2v4971, d2v49e1, d2v49h1, d2v49h2, d2v49n1, d2v49p1, d2v49t1, d2v49u1, d2v49v1, d2v49y1, d2v49z1
    automatically matched to 2J01 F:1-208

Details for d2v49f1

PDB Entry: 2v49 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 4 of 4). This file contains the 50S subunit of Molecule 2.
PDB Compounds: (F:) 50S ribosomal protein L4

SCOP Domain Sequences for d2v49f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v49f1 c.22.1.1 (F:1-208) Ribosomal protein L4 {Thermus thermophilus [TaxId: 274]}
mkevavyqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevays
grkiwpqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadrare
gklllveafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapeg
lnvydivrterlvmdldawevfqnrigg

SCOP Domain Coordinates for d2v49f1:

Click to download the PDB-style file with coordinates for d2v49f1.
(The format of our PDB-style files is described here.)

Timeline for d2v49f1: