Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies) core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) automatically mapped to Pfam PF01765 |
Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins) |
Protein Ribosome recycling factor, RRF [55196] (7 species) |
Species Thermus thermophilus [TaxId:274] [55198] (9 PDB entries) |
Domain d2v48y1: 2v48 Y:1-185 [152540] Other proteins in same PDB: d2v48b1, d2v48d1, d2v48e1, d2v48f1, d2v48g1, d2v48h1, d2v48i1, d2v48j1, d2v48k1, d2v48l1, d2v48m1, d2v48n1, d2v48o1, d2v48p1, d2v48q1, d2v48r1, d2v48s1, d2v48t1, d2v48u1 complexed with mg, zn complexed with mg, zn |
PDB Entry: 2v48 (more details), 3.8 Å
SCOPe Domain Sequences for d2v48y1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v48y1 d.67.3.1 (Y:1-185) Ribosome recycling factor, RRF {Thermus thermophilus [TaxId: 274]} mtlkelyaetrshmqkslevlehnlaglrtgranpalllhlkveyygahvplnqiatvta pdprtlvvqswdqnalkaiekairdsdlglnpsnkgdalyinipplteerrkdlvravrq yaeegrvairnirrealdklkklakelhlsedetkraeaeiqkitdefiakadqlaekke qeilg
Timeline for d2v48y1: