Lineage for d2v46y1 (2v46 Y:1-185)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956973Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2957018Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) (S)
    automatically mapped to Pfam PF01765
  5. 2957019Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)
  6. 2957020Protein Ribosome recycling factor, RRF [55196] (7 species)
  7. 2957036Species Thermus thermophilus [TaxId:274] [55198] (9 PDB entries)
  8. 2957040Domain d2v46y1: 2v46 Y:1-185 [152504]
    Other proteins in same PDB: d2v46b1, d2v46d1, d2v46e1, d2v46f1, d2v46g1, d2v46h1, d2v46i1, d2v46j1, d2v46k1, d2v46l1, d2v46m1, d2v46n1, d2v46o1, d2v46p1, d2v46q1, d2v46r1, d2v46s1, d2v46t1, d2v46u1
    complexed with mg, zn
    complexed with mg, zn

Details for d2v46y1

PDB Entry: 2v46 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 1 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 1.
PDB Compounds: (Y:) ribosome recycling factor

SCOPe Domain Sequences for d2v46y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v46y1 d.67.3.1 (Y:1-185) Ribosome recycling factor, RRF {Thermus thermophilus [TaxId: 274]}
mtlkelyaetrshmqkslevlehnlaglrtgranpalllhlkveyygahvplnqiatvta
pdprtlvvqswdqnalkaiekairdsdlglnpsnkgdalyinipplteerrkdlvravrq
yaeegrvairnirrealdklkklakelhlsedetkraeaeiqkitdefiakadqlaekke
qeilg

SCOPe Domain Coordinates for d2v46y1:

Click to download the PDB-style file with coordinates for d2v46y1.
(The format of our PDB-style files is described here.)

Timeline for d2v46y1: