Lineage for d2uxdl1 (2uxd L:5-128)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3042558Protein 70S ribosome functional complex [58121] (4 species)
  7. 3043115Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 3043188Domain d2uxdl1: 2uxd L:5-128 [152292]
    Other proteins in same PDB: d2uxdb1, d2uxdd1, d2uxde1, d2uxdf1, d2uxdg1, d2uxdh1, d2uxdi1, d2uxdj1, d2uxdk1, d2uxdm1, d2uxdn1, d2uxdq1, d2uxdr1, d2uxdt1, d2uxdv1
    automatically matched to d1gixo_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxdl1

PDB Entry: 2uxd (more details), 3.2 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (L:) ribosomal protein s12

SCOPe Domain Sequences for d2uxdl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxdl1 i.1.1.1 (L:5-128) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOPe Domain Coordinates for d2uxdl1:

Click to download the PDB-style file with coordinates for d2uxdl1.
(The format of our PDB-style files is described here.)

Timeline for d2uxdl1: