Class a: All alpha proteins [46456] (171 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (18 proteins) Heme-binding protein |
Protein Leghemoglobin [46481] (2 species) |
Species Yellow lupin (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries) |
Domain d2lh3__: 2lh3 - [15224] complexed with hem |
PDB Entry: 2lh3 (more details), 2 Å
SCOP Domain Sequences for d2lh3__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lh3__ a.1.1.2 (-) Leghemoglobin {Yellow lupin (Lupinus luteus)} galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike vvgakwseelnsawtiaydelaivikkemddaa
Timeline for d2lh3__: