SCOPe 2.07: Domain d2uwsl_: 2uws L:

Lineage for d2uwsl_ (2uws L:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (14 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [186985] (32 PDB entries)

8. Domain d2uwsl_: 2uws L: [152221]
   Other proteins in same PDB: d2uwsh1, d2uwsh2
   automated match to d1aigl_
   complexed with bcl, bph, fe, gol, lda, po4, spo, u10, uq2

Details for d2uwsl_

PDB Entry: 2uws, 2.9 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 6.5 in the charge-separated state

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d2uwsl_:

Sequence, based on SEQRES records:

>d2uwsl_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Sequence, based on observed residues (ATOM records):

>d2uwsl_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdedtffrdlvgysigtlgihrlglllslsav
ffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d2uwsl_:

• d2uwsl_ first appeared in SCOP 1.75, called d2uwsl1
  
• d2uwsl_ appears in SCOPe 2.06
  
• d2uwsl_ appears in the current release, SCOPe 2.08