SCOPe 2.08: Domain d2uweh1: 2uwe H:182-275

Lineage for d2uweh1 (2uwe H:182-275)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d2uweh1: 2uwe H:182-275 [152213]
   Other proteins in same PDB: d2uwea2, d2uweb2, d2uweb3, d2uwee1, d2uwee2, d2uwef1, d2uwef2, d2uweh2, d2uwei2, d2uwei3, d2uwel1, d2uwel2, d2uwem1, d2uwem2
   automatically matched to d1akja1
   mutant

Details for d2uweh1

PDB Entry: 2uwe, 2.4 Å

PDB Description: large cdr3a loop alteration as a function of mhc mutation

PDB Compounds: (H:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d2uweh1:

Sequence; same for both SEQRES and ATOM records:

>d2uweh1 b.1.1.2 (H:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d2uweh1:

• d2uweh1 first appeared in SCOP 1.75
  
• d2uweh1 appears in SCOPe 2.07