SCOPe 2.07: Domain d2rn8a2: 2rn8 A:171-232

Lineage for d2rn8a2 (2rn8 A:171-232)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (8 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187043] (7 PDB entries)

8. Domain d2rn8a2: 2rn8 A:171-232 [152170]
   Other proteins in same PDB: d2rn8a3
   automated match to d3h0ha_

Details for d2rn8a2

PDB Entry: 2rn8

PDB Description: nmr structure note: murine itk sh3 domain

PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d2rn8a2:

Sequence; same for both SEQRES and ATOM records:

>d2rn8a2 b.34.2.1 (A:171-232) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
peetlvialydyqtndpqelalrcdeeyylldsseihwwrvqdknghegyapssylveks
pn

Timeline for d2rn8a2:

• d2rn8a2 first appeared in SCOP 1.75, called d2rn8a1
  
• d2rn8a2 appears in SCOPe 2.06
  
• d2rn8a2 appears in the current release, SCOPe 2.08