Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) |
Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) |
Protein Surfactant protein [57949] (2 species) |
Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (24 PDB entries) |
Domain d2rica2: 2ric A:201-234 [152072] Other proteins in same PDB: d2rica1, d2ricb1, d2ricc1 complexed with ca, gmh |
PDB Entry: 2ric (more details), 1.8 Å
SCOPe Domain Sequences for d2rica2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rica2 h.1.1.1 (A:201-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]} gsdvaslrqqvealqgqvqhlqaafsqykkvelf
Timeline for d2rica2:
View in 3D Domains from other chains: (mouse over for more information) d2ricb1, d2ricb2, d2ricc1, d2ricc2 |