SCOPe 2.07: Domain d2rhwa_: 2rhw A:

Lineage for d2rhwa_ (2rhw A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.10: Carbon-carbon bond hydrolase [53522] (3 proteins)
   closely related to the Proline iminopeptidase-like family

6. Protein 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) [53523] (2 species)

7. Species Burkholderia xenovorans [TaxId:36873] [159736] (13 PDB entries)
   Uniprot P47229 4-286

8. Domain d2rhwa_: 2rhw A: [152053]
   automated match to d2puha1
   complexed with c0e, mli, na; mutant

Details for d2rhwa_

PDB Entry: 2rhw, 1.57 Å

PDB Description: crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3,10-di-fluoro hopda

PDB Compounds: (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase

SCOPe Domain Sequences for d2rhwa_:

Sequence; same for both SEQRES and ATOM records:

>d2rhwa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}
ltesstskfvkinekgfsdfnihyneagngetvimlhgggpgaggwsnyyrnvgpfvdag
yrvilkdspgfnksdavvmdeqrglvnaravkglmdaldidrahlvgnamggatalnfal
eypdrigklilmgpgglgpsmfapmpmegikllfklyaepsyetlkqmlqvflydqslit
eellqgrweaiqrqpehlknflisaqkaplstwdvtarlgeikaktfitwgrddrfvpld
hglkllwniddarlhvfskcghwaqwehadefnrlvidflrha

Timeline for d2rhwa_:

• d2rhwa_ first appeared in SCOP 1.75, called d2rhwa1
  
• d2rhwa_ appears in SCOPe 2.06
  
• d2rhwa_ appears in the current release, SCOPe 2.08