Lineage for d2mm1__ (2mm1 -)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (18 proteins) Protein Myoglobin [46469] (9 species) 
Species Human (Homo sapiens) [TaxId:9606] [46475] (1 PDB entry) 
Domain d2mm1__: 2mm1 - [15203]
Details for d2mm1__
PDB Entry: 2mm1 (more details), 2.8 Å
PDB Description: x-ray crystal structure of a recombinant human myoglobin mutant at 2.8 angstroms resolution
SCOP Domain Sequences for d2mm1__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mm1__ a.1.1.2 (-) Myoglobin {Human (Homo sapiens)}
glsdgewqlvlnvwgkveadipghgqevlirlfkghpetlekfdrfkhlksedemkased
lkkhgatvltalggilkkkghheaeikplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamnkalelfrkdmasnykelgfqg
SCOP Domain Coordinates for d2mm1__:
Click to download the PDB-style file with coordinates for d2mm1__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2mm1__:
- d2mm1__ first appeared (with stable ids) in SCOP 1.55
- d2mm1__ appears in SCOP 1.57
- d2mm1__ appears in SCOP 1.61
- d2mm1__ last appears in SCOP 1.75, called d2mm1a_
View in 3D