Lineage for d1dwra_ (1dwr A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1255251Protein Myoglobin [46469] (9 species)
  7. 1255256Species Horse (Equus caballus) [TaxId:9796] [46474] (62 PDB entries)
  8. 1255277Domain d1dwra_: 1dwr A: [15192]
    complexed with cmo, hem, so4

Details for d1dwra_

PDB Entry: 1dwr (more details), 1.45 Å

PDB Description: myoglobin (horse heart) wild-type complexed with co
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1dwra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwra_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

SCOPe Domain Coordinates for d1dwra_:

Click to download the PDB-style file with coordinates for d1dwra_.
(The format of our PDB-style files is described here.)

Timeline for d1dwra_: