Lineage for d1dwta_ (1dwt A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1255251Protein Myoglobin [46469] (9 species)
  7. 1255256Species Horse (Equus caballus) [TaxId:9796] [46474] (62 PDB entries)
  8. 1255274Domain d1dwta_: 1dwt A: [15190]
    complexed with cmo, hem, so4

Details for d1dwta_

PDB Entry: 1dwt (more details), 1.4 Å

PDB Description: photorelaxed horse heart myoglobin co complex
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1dwta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwta_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

SCOPe Domain Coordinates for d1dwta_:

Click to download the PDB-style file with coordinates for d1dwta_.
(The format of our PDB-style files is described here.)

Timeline for d1dwta_: