Lineage for d2r92f1 (2r92 F:72-155)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347782Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2347783Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2347834Family a.143.1.2: RPB6 [55294] (2 proteins)
  6. 2347835Protein RPB6 [55295] (3 species)
    essential subunit of RNA polymerases I, II and III
  7. 2347836Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (31 PDB entries)
    Uniprot P20435; part of multichain biological unit
  8. 2347862Domain d2r92f1: 2r92 F:72-155 [151748]
    Other proteins in same PDB: d2r92a1, d2r92b1, d2r92d1, d2r92g1, d2r92h1, d2r92j1, d2r92k1, d2r92l1
    automatically matched to d1i3qf_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2r92f1

PDB Entry: 2r92 (more details), 3.8 Å

PDB Description: elongation complex of rna polymerase ii with artificial rdrp scaffold
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III subunit RPABC2

SCOPe Domain Sequences for d2r92f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r92f1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOPe Domain Coordinates for d2r92f1:

Click to download the PDB-style file with coordinates for d2r92f1.
(The format of our PDB-style files is described here.)

Timeline for d2r92f1: