SCOPe 2.03: Domain d2r6gf2: 2r6g F:261-504

Lineage for d2r6gf2 (2r6g F:261-504)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.58: MetI-like [161097] (1 superfamily)
   core: 5 transmembrane helices; flattened bundle

4. Superfamily f.58.1: MetI-like [161098] (1 family)

5. Family f.58.1.1: MetI-like [161099] (6 proteins)
   Pfam PF00528; Binding-protein-dependent transport system inner membrane component

6. Protein Maltose transport system permease protein MalF [161106] (1 species)

7. Species Escherichia coli [TaxId:562] [161107] (8 PDB entries)
   Uniprot P02916 261-504

8. Domain d2r6gf2: 2r6g F:261-504 [151610]
   Other proteins in same PDB: d2r6ga1, d2r6ga2, d2r6gb1, d2r6gb2, d2r6ge_, d2r6gf1, d2r6gg1
   complexed with atp, mal

Details for d2r6gf2

PDB Entry: 2r6g, 2.8 Å

PDB Description: the crystal structure of the e. coli maltose transporter

PDB Compounds: (F:) Maltose transport system permease protein malF

SCOPe Domain Sequences for d2r6gf2:

Sequence; same for both SEQRES and ATOM records:

>d2r6gf2 f.58.1.1 (F:261-504) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]}
wknftrvftdegiqkpflaifvwtvvfslitvfltvavgmvlaclvqwealrgkavyrvl
lilpyavpsfisilifkglfnqsfgeinmmlsalfgvkpawfsdpttartmliivntwlg
ypymmilcmgllkaipddlyeasamdgagpfqnffkitlpllikpltplmiasfafnfnn
fvliqlltnggpdrlgtttpagytdllvnytyriafeggggqdfglaaaiatlifllvga
laiv

Timeline for d2r6gf2:

• d2r6gf2 first appeared in SCOP 1.75
  
• d2r6gf2 appears in SCOPe 2.02
  
• d2r6gf2 appears in SCOPe 2.04
  
• d2r6gf2 appears in the current release, SCOPe 2.08