Lineage for d2r6ge_ (2r6g E:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624948Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1624949Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1624950Family c.94.1.1: Phosphate binding protein-like [53851] (42 proteins)
  6. 1624999Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 1625013Species Escherichia coli [TaxId:562] [53863] (62 PDB entries)
    Uniprot P02928
  8. 1625067Domain d2r6ge_: 2r6g E: [151608]
    Other proteins in same PDB: d2r6ga1, d2r6ga2, d2r6gb1, d2r6gb2, d2r6gf1, d2r6gf2, d2r6gg1
    automated match to d1anfa_
    complexed with atp, mal

Details for d2r6ge_

PDB Entry: 2r6g (more details), 2.8 Å

PDB Description: the crystal structure of the e. coli maltose transporter
PDB Compounds: (E:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d2r6ge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r6ge_ c.94.1.1 (E:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritk

SCOPe Domain Coordinates for d2r6ge_:

Click to download the PDB-style file with coordinates for d2r6ge_.
(The format of our PDB-style files is described here.)

Timeline for d2r6ge_: