Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein automated matches [190360] (2 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187191] (5 PDB entries) |
Domain d2r5zb_: 2r5z B: [151598] automated match to d1pufb_ protein/DNA complex |
PDB Entry: 2r5z (more details), 2.6 Å
SCOPe Domain Sequences for d2r5zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r5zb_ a.4.1.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} rrnfskqaseilneyfyshlsnpypseeakeelarkcgitvsqvsnwfgnkrirykkni
Timeline for d2r5zb_: