Lineage for d2qrec_ (2qre C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668833Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1669564Superfamily d.129.6: KA1-like [103243] (3 families) (S)
    contains a single copy of this fold
  5. 1669573Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins)
    PfamB PB166430
  6. 1669581Protein Snf1-like protein kinase ssp2 [160726] (1 species)
  7. 1669582Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [160727] (6 PDB entries)
    Uniprot O74536 449-576
  8. 1669592Domain d2qrec_: 2qre C: [151292]
    Other proteins in same PDB: d2qreb_, d2qred_, d2qree1, d2qree2, d2qreg1, d2qreg2
    automated match to d2ooya_
    complexed with amz

Details for d2qrec_

PDB Entry: 2qre (more details), 3.01 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with 5-aminoimidazole-4-carboxamide 1-beta-D-ribofuranotide (ZMP)
PDB Compounds: (C:) SNF1-like protein kinase ssp2

SCOPe Domain Sequences for d2qrec_:

Sequence, based on SEQRES records: (download)

>d2qrec_ d.129.6.2 (C:) Snf1-like protein kinase ssp2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
nkwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiksrweiphckre
gkntyayielqlyevmpgcfmldvksngykdiyshpertadhgmddlkssfpfldlcaml
vcklfsa

Sequence, based on observed residues (ATOM records): (download)

>d2qrec_ d.129.6.2 (C:) Snf1-like protein kinase ssp2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
nkwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiksrweiphckre
gkntyayielqlyevmpgcfmldvksngykddlkssfpfldlcamlvcklfsa

SCOPe Domain Coordinates for d2qrec_:

Click to download the PDB-style file with coordinates for d2qrec_.
(The format of our PDB-style files is described here.)

Timeline for d2qrec_: