SCOPe 2.08: Domain d2qr0m1: 2qr0 M:1-107

Lineage for d2qr0m1 (2qr0 M:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (31 PDB entries)

8. Domain d2qr0m1: 2qr0 M:1-107 [151254]
   Other proteins in same PDB: d2qr0a2, d2qr0b1, d2qr0b2, d2qr0c1, d2qr0d1, d2qr0e2, d2qr0f1, d2qr0f2, d2qr0g2, d2qr0h1, d2qr0h2, d2qr0i1, d2qr0j1, d2qr0k2, d2qr0l1, d2qr0l2, d2qr0m2, d2qr0n1, d2qr0n2, d2qr0o1, d2qr0p1, d2qr0q2, d2qr0r1, d2qr0r2, d2qr0s2, d2qr0t1, d2qr0t2, d2qr0u1, d2qr0v1, d2qr0w2, d2qr0x1, d2qr0x2
   automatically matched to d1g9ml1

Details for d2qr0m1

PDB Entry: 2qr0, 3.5 Å

PDB Description: structure of vegf complexed to a fab containing tyr and ser in the cdrs

PDB Compounds: (M:) Fab-Fragment Light Chain

SCOPe Domain Sequences for d2qr0m1:

Sequence; same for both SEQRES and ATOM records:

>d2qr0m1 b.1.1.1 (M:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
rfsgsrsgtdftltisslqpedfatyycqqysyyyypftfgqgtkveik

Timeline for d2qr0m1:

• d2qr0m1 first appeared in SCOP 1.75
  
• d2qr0m1 appears in SCOPe 2.07