Lineage for d2qqrb2 (2qqr B:956-1011)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1537363Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1537364Family b.34.9.1: Tudor domain [63749] (8 proteins)
    Pfam PF00567
  6. 1537365Protein Jumonji domain-containing protein 2A [141203] (1 species)
    contains tandem repeat of two segment-swapped Tudor domains
  7. 1537366Species Human (Homo sapiens) [TaxId:9606] [141204] (4 PDB entries)
    Uniprot O75164 897-955! Uniprot O75164 956-1011
  8. 1537370Domain d2qqrb2: 2qqr B:956-1011 [151229]
    automated match to d2qqra2
    complexed with so4

Details for d2qqrb2

PDB Entry: 2qqr (more details), 1.8 Å

PDB Description: JMJD2A hybrid tudor domains
PDB Compounds: (B:) JmjC domain-containing histone demethylation protein 3A

SCOPe Domain Sequences for d2qqrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qqrb2 b.34.9.1 (B:956-1011) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]}
ppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp

SCOPe Domain Coordinates for d2qqrb2:

Click to download the PDB-style file with coordinates for d2qqrb2.
(The format of our PDB-style files is described here.)

Timeline for d2qqrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qqrb1