![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Plant alpha-amylase [51040] (2 species) single beta-sheet; probable result of a decay of the common-fold |
![]() | Species Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89384] (8 PDB entries) |
![]() | Domain d2qpub1: 2qpu B:348-404 [151211] Other proteins in same PDB: d2qpua2, d2qpub2, d2qpuc2 automatically matched to d1ht6a1 complexed with ca, edo, glc, qps, qpu; mutant |
PDB Entry: 2qpu (more details), 1.7 Å
SCOP Domain Sequences for d2qpub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qpub1 b.71.1.1 (B:348-404) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} itatsalkilmhegdayvaeidgkvvvkigprydvgavipagfvtsahgndyavwek
Timeline for d2qpub1:
![]() Domains from other chains: (mouse over for more information) d2qpua1, d2qpua2, d2qpuc1, d2qpuc2 |