Lineage for d1ht6a1 (1ht6 A:348-404)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 808141Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 808142Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 808143Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 808494Protein Plant alpha-amylase [51040] (2 species)
    single beta-sheet; probable result of a decay of the common-fold
  7. 808495Species Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89384] (8 PDB entries)
  8. 808496Domain d1ht6a1: 1ht6 A:348-404 [83629]
    Other proteins in same PDB: d1ht6a2
    complexed with ca, edo

Details for d1ht6a1

PDB Entry: 1ht6 (more details), 1.5 Å

PDB Description: crystal structure at 1.5a resolution of the barley alpha-amylase isozyme 1
PDB Compounds: (A:) alpha-amylase isozyme 1

SCOP Domain Sequences for d1ht6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ht6a1 b.71.1.1 (A:348-404) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]}
itatsalkilmhegdayvaeidgkvvvkigsrydvgavipagfvtsahgndyavwek

SCOP Domain Coordinates for d1ht6a1:

Click to download the PDB-style file with coordinates for d1ht6a1.
(The format of our PDB-style files is described here.)

Timeline for d1ht6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ht6a2