![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein) |
![]() | Protein Ribosomal protein S14 [57753] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [161162] (24 PDB entries) Uniprot P02370 1-100 |
![]() | Domain d2qoyn1: 2qoy N:1-100 [151104] Other proteins in same PDB: d2qoyb1, d2qoyc1, d2qoyc2, d2qoyd1, d2qoye1, d2qoye2, d2qoyf1, d2qoyg1, d2qoyh1, d2qoyi1, d2qoyj1, d2qoyk1, d2qoyl1, d2qoym1, d2qoyp1, d2qoyq1, d2qoyr1, d2qoys1, d2qoyt1, d2qoyu1 protein/RNA complex; complexed with mg, nmy, scm protein/RNA complex; complexed with mg, nmy, scm has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2qoy (more details), 3.5 Å
SCOPe Domain Sequences for d2qoyn1:
Sequence, based on SEQRES records: (download)
>d2qoyn1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]} akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw
>d2qoyn1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]} akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr qtgrphgflrkfglsrikvreaamrgeipglkkasw
Timeline for d2qoyn1: