Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (3 families) |
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
Protein Ribosomal protein S11 [53141] (2 species) |
Species Escherichia coli [TaxId:562] [159644] (24 PDB entries) Uniprot P0A7R9 12-128 |
Domain d2qoyk1: 2qoy K:12-128 [151101] Other proteins in same PDB: d2qoyb1, d2qoyc1, d2qoyc2, d2qoyd1, d2qoye1, d2qoye2, d2qoyf1, d2qoyg1, d2qoyh1, d2qoyi1, d2qoyj1, d2qoyl1, d2qoym1, d2qoyn1, d2qoyp1, d2qoyq1, d2qoyr1, d2qoys1, d2qoyt1, d2qoyu1 protein/RNA complex; complexed with mg, nmy, scm protein/RNA complex; complexed with mg, nmy, scm |
PDB Entry: 2qoy (more details), 3.5 Å
SCOPe Domain Sequences for d2qoyk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qoyk1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]} rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv
Timeline for d2qoyk1: