Lineage for d2qoye1 (2qoy E:78-158)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930061Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2930109Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)
  7. 2930112Species Escherichia coli [TaxId:562] [159906] (24 PDB entries)
    Uniprot P0A7W1 78-158
  8. 2930117Domain d2qoye1: 2qoy E:78-158 [151094]
    Other proteins in same PDB: d2qoyb1, d2qoyc1, d2qoyc2, d2qoyd1, d2qoye2, d2qoyf1, d2qoyg1, d2qoyh1, d2qoyi1, d2qoyj1, d2qoyk1, d2qoyl1, d2qoym1, d2qoyn1, d2qoyp1, d2qoyq1, d2qoyr1, d2qoys1, d2qoyt1, d2qoyu1
    protein/RNA complex; complexed with mg, nmy, scm
    protein/RNA complex; complexed with mg, nmy, scm

Details for d2qoye1

PDB Entry: 2qoy (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2qoye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qoye1 d.14.1.1 (E:78-158) Ribosomal protein S5, C-terminal domain {Escherichia coli [TaxId: 562]}
gtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakaygstnpinvvr
atidglenmnspemvaakrgk

SCOPe Domain Coordinates for d2qoye1:

Click to download the PDB-style file with coordinates for d2qoye1.
(The format of our PDB-style files is described here.)

Timeline for d2qoye1: