Lineage for d1hjt__ (1hjt -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93460Family a.1.1.2: Globins [46463] (18 proteins)
  6. 94046Protein Myoglobin [46469] (9 species)
  7. 94112Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (136 PDB entries)
  8. 94142Domain d1hjt__: 1hjt - [15046]

Details for d1hjt__

PDB Entry: 1hjt (more details), 1.7 Å

PDB Description: sperm whale myoglobin (ferrous, nitric oxide bound)

SCOP Domain Sequences for d1hjt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjt__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d1hjt__:

Click to download the PDB-style file with coordinates for d1hjt__.
(The format of our PDB-style files is described here.)

Timeline for d1hjt__: