![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Ribosomal protein S17 [50304] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [159088] (26 PDB entries) Uniprot P02373 3-82 |
![]() | Domain d2qbdq1: 2qbd Q:3-82 [150449] Other proteins in same PDB: d2qbdb1, d2qbdc1, d2qbdc2, d2qbdd1, d2qbde1, d2qbde2, d2qbdf1, d2qbdg1, d2qbdh1, d2qbdi1, d2qbdj1, d2qbdk1, d2qbdl1, d2qbdm1, d2qbdn1, d2qbdp1, d2qbdr1, d2qbds1, d2qbdt1, d2qbdu1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2qbd (more details), 3.3 Å
SCOPe Domain Sequences for d2qbdq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbdq1 b.40.4.5 (Q:3-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]} kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire crplsktkswtlvrvvekav
Timeline for d2qbdq1: