Lineage for d2qbbb1 (2qbb B:8-225)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1589041Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 1589042Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 1589043Protein Ribosomal protein S2 [52315] (3 species)
  7. 1589053Species Escherichia coli [TaxId:562] [159491] (26 PDB entries)
    Uniprot P0A7V0 8-225
  8. 1589067Domain d2qbbb1: 2qbb B:8-225 [150380]
    Other proteins in same PDB: d2qbbc1, d2qbbc2, d2qbbd1, d2qbbe1, d2qbbe2, d2qbbf1, d2qbbg1, d2qbbh1, d2qbbi1, d2qbbj1, d2qbbk1, d2qbbl1, d2qbbm1, d2qbbn1, d2qbbp1, d2qbbq1, d2qbbr1, d2qbbs1, d2qbbt1, d2qbbu1
    automatically matched to 2AVY B:8-225
    protein/RNA complex; complexed with lll, mg

Details for d2qbbb1

PDB Entry: 2qbb (more details), 3.54 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. This file contains the 30S subunit of the second 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (B:) 30S ribosomal protein S2

SCOPe Domain Sequences for d2qbbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbbb1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]}
mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil
fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk
ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd
tnsdpdgvdfvipgnddairavtlylgavaatvregrs

SCOPe Domain Coordinates for d2qbbb1:

Click to download the PDB-style file with coordinates for d2qbbb1.
(The format of our PDB-style files is described here.)

Timeline for d2qbbb1: