Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Fructose-1,6-bisphosphate aldolase [51576] (10 species) |
Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51582] (4 PDB entries) |
Domain d2qapc1: 2qap C:1-357 [150322] automatically matched to d1epxa_ complexed with po4 |
PDB Entry: 2qap (more details), 1.59 Å
SCOPe Domain Sequences for d2qapc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qapc1 c.1.10.1 (C:1-357) Fructose-1,6-bisphosphate aldolase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} msrvtvlqsqlpaynrlktpyeseliatvkklttpgkgllaadesigsctkrfqpiglsn teehrrqyralmleaegfeqyisgvilhdetvgqkasngqtfpeyltargvvpgiktdmg lcpllegaegeqmtegldgyvkrasayykkgcrfckwrnvykiqngtvsesavrfnaetl aryailsqmsglvpivepevmidgkhdidtcqrvsehvwrevvaalqrhgviwegcllkp nmvvpgaesgktaapeqvahytvmtlartmpamlpgvmflsgglsevqaseylnainnsp lprpyflsfsyaralqssalkawggkesglaagrraflhrarmnsmaqlgkykrsdd
Timeline for d2qapc1: