SCOPe 2.08: Domain d2qadb2: 2qad B:98-178

Lineage for d2qadb2 (2qad B:98-178)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries)

8. Domain d2qadb2: 2qad B:98-178 [150204]
   Other proteins in same PDB: d2qadb1, d2qadd1, d2qadd2, d2qadf1, d2qadh1, d2qadh2
   automatically matched to d1g9mc2
   complexed with edo, mla, nag

Details for d2qadb2

PDB Entry: 2qad, 3.3 Å

PDB Description: structure of tyrosine-sulfated 412d antibody complexed with hiv-1 yu2 gp120 and cd4

PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2qadb2:

Sequence; same for both SEQRES and ATOM records:

>d2qadb2 b.1.1.3 (B:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

Timeline for d2qadb2:

• d2qadb2 first appeared in SCOP 1.75
  
• d2qadb2 appears in SCOPe 2.07