Lineage for d1moh__ (1moh -)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (18 proteins) 
Protein Hemoglobin I [46464] (2 species) Species Clam (Lucina pectinata) [TaxId:244486] [46466] (4 PDB entries) 
Domain d1moh__: 1moh - [15012]
Details for d1moh__
PDB Entry: 1moh (more details), 1.9 Å
PDB Description: ferric monomeric hemoglobin i (hb i)
SCOP Domain Sequences for d1moh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1moh__ a.1.1.2 (-) Hemoglobin I {Clam (Lucina pectinata)}
sleaaqksnvtsswakasaawgtagpeffmalfdahddvfakfsglfsgaakgtvkntpe
maaqaqsfkglvsnwvdnldnagalegqcktfaanhkargisagqleaafkvlsgfmksy
ggdegawtavagalmgeiepdm
SCOP Domain Coordinates for d1moh__:
Click to download the PDB-style file with coordinates for d1moh__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1moh__:
- d1moh__ first appeared (with stable ids) in SCOP 1.55
- d1moh__ appears in SCOP 1.57
- d1moh__ appears in SCOP 1.61
- d1moh__ appears in the current release, SCOPe 2.08, called d1moha_
View in 3D