Lineage for d2q66a2 (2q66 A:5-201)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612756Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2612757Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2613074Family d.218.1.3: Poly(A) polymerase, PAP, N-terminal domain [81589] (1 protein)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543
  6. 2613075Protein Poly(A) polymerase, PAP, N-terminal domain [81588] (2 species)
  7. 2613076Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81586] (5 PDB entries)
  8. 2613078Domain d2q66a2: 2q66 A:5-201 [150058]
    Other proteins in same PDB: d2q66a1, d2q66a3
    automatically matched to d1fa0b4
    protein/RNA complex; complexed with atp, edo, mg

Details for d2q66a2

PDB Entry: 2q66 (more details), 1.8 Å

PDB Description: structure of yeast poly(a) polymerase with atp and oligo(a)
PDB Compounds: (A:) poly(a) polymerase

SCOPe Domain Sequences for d2q66a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q66a2 d.218.1.3 (A:5-201) Poly(A) polymerase, PAP, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqrfvy
evskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfdsll
rerkeldeiapvpdafvpiikikfsgisialicarldqpqvplsltlsdknllrnldekd
lralngtrvtdeilelv

SCOPe Domain Coordinates for d2q66a2:

Click to download the PDB-style file with coordinates for d2q66a2.
(The format of our PDB-style files is described here.)

Timeline for d2q66a2: