Lineage for d2pv2a_ (2pv2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941556Protein Porin chaperone SurA, PPIase domains [82624] (1 species)
  7. 2941557Species Escherichia coli [TaxId:562] [82625] (4 PDB entries)
  8. 2941558Domain d2pv2a_: 2pv2 A: [149878]
    automated match to d2pv2a1
    has additional insertions and/or extensions that are not grouped together

Details for d2pv2a_

PDB Entry: 2pv2 (more details), 1.3 Å

PDB Description: crystallographic structure of sura first peptidyl-prolyl isomerase domain complexed with peptide nftlkfwdifrk
PDB Compounds: (A:) Chaperone surA

SCOPe Domain Sequences for d2pv2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pv2a_ d.26.1.1 (A:) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]}
telnlshiliplpenptsdqvneaesqaraivdqarngadfgklaiahsadqqalnggqm
gwgriqelpgifaqalstakkgdivgpirsgvgfhilkvndlr

SCOPe Domain Coordinates for d2pv2a_:

Click to download the PDB-style file with coordinates for d2pv2a_.
(The format of our PDB-style files is described here.)

Timeline for d2pv2a_: