SCOP 1.59: Domain d3sdhb_: 3sdh B:

Lineage for d3sdhb_ (3sdh B:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (14 PDB entries)

8. Domain d3sdhb_: 3sdh B: [14985]

Details for d3sdhb_

PDB Entry: 3sdh, 1.4 Å

PDB Description: high resolution crystallographic analysis of a cooperative dimeric hemoglobin

SCOP Domain Sequences for d3sdhb_:

Sequence; same for both SEQRES and ATOM records:

>d3sdhb_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis)}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d3sdhb_:

• d3sdhb_ first appeared (with stable ids) in SCOP 1.55
  
• d3sdhb_ appears in SCOP 1.57
  
• d3sdhb_ appears in SCOP 1.61
  
• d3sdhb_ appears in the current release, SCOPe 2.08