Lineage for d2pf5e_ (2pf5 E:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1443066Family d.169.1.4: Link domain [56477] (3 proteins)
  6. 1443073Protein TSG-6, Link module [56478] (1 species)
  7. 1443074Species Human (Homo sapiens) [TaxId:9606] [56479] (3 PDB entries)
  8. 1443079Domain d2pf5e_: 2pf5 E: [149451]
    automated match to d1o7bt_
    complexed with 2pe, so4

Details for d2pf5e_

PDB Entry: 2pf5 (more details), 1.9 Å

PDB Description: Crystal Structure of the Human TSG-6 Link Module
PDB Compounds: (E:) tumor necrosis factor-inducible protein tsg-6

SCOPe Domain Sequences for d2pf5e_:

Sequence, based on SEQRES records: (download)

>d2pf5e_ d.169.1.4 (E:) TSG-6, Link module {Human (Homo sapiens) [TaxId: 9606]}
gvyhrearsgkykltyaeakavcefegghlatykqleaarkigfhvcaagwmakgrvgyp
ivkpgpncgfgktgiidygirlnrserwdaycynpha

Sequence, based on observed residues (ATOM records): (download)

>d2pf5e_ d.169.1.4 (E:) TSG-6, Link module {Human (Homo sapiens) [TaxId: 9606]}
gvyhrearsgkykltyaeakavcefegghlatykqleaarkigfhvcaagwmakgrvgyp
igiidygirlnrserwdaycynpha

SCOPe Domain Coordinates for d2pf5e_:

Click to download the PDB-style file with coordinates for d2pf5e_.
(The format of our PDB-style files is described here.)

Timeline for d2pf5e_: