Lineage for d2p41a1 (2p41 A:8-264)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839581Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 839582Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) (S)
  5. 839998Family c.66.1.25: mRNA cap methylase [88785] (2 proteins)
  6. 839999Protein An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 [89741] (2 species)
    structurally and functionally similar to VP39
  7. 840000Species Dengue virus 2 [TaxId:11060] [159679] (5 PDB entries)
  8. 840001Domain d2p41a1: 2p41 A:8-264 [149193]
    automatically matched to d1l9ka_
    complexed with cit, g1g, gol, sah, so4

Details for d2p41a1

PDB Entry: 2p41 (more details), 1.8 Å

PDB Description: Crystal Structure of Dengue Methyltransferase in Complex with 7MeGpppG2'OMe and S-Adenosyl-L-homocysteine
PDB Compounds: (A:) type II methyltransferase

SCOP Domain Sequences for d2p41a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]}
tlgekwksrlnalgksefqiykksgiqevdrtlakegikrgetdhhavsrgsaklrwfve
rnlvtpegkvvdlgcgrggwsyycgglknvrevkgltkggpgheepipmstygwnlvrlq
sgvdvffippercdtllcdigesspnptveagrtlrvlnlvenwlsnntqfcvkvlnpym
ssviekmealqrkhggalvrnplsrnsthemywvsnasgnivssvnmisrmlinrftmrh
kkatyepdvdlgsgtrn

SCOP Domain Coordinates for d2p41a1:

Click to download the PDB-style file with coordinates for d2p41a1.
(The format of our PDB-style files is described here.)

Timeline for d2p41a1: