SCOP 1.75: Domain d2p3qa1: 2p3q A:8-264

Lineage for d2p3qa1 (2p3q A:8-264)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families)

5. Family c.66.1.25: mRNA cap methylase [88785] (2 proteins)

6. Protein An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 [89741] (2 species)
   structurally and functionally similar to VP39

7. Species Dengue virus 2 [TaxId:11060] [159679] (5 PDB entries)

8. Domain d2p3qa1: 2p3q A:8-264 [149185]
   automatically matched to d1l9ka_
   complexed with gp3, sah, so4

Details for d2p3qa1

PDB Entry: 2p3q, 2.75 Å

PDB Description: Crystal Structure of Dengue Methyltransferase in Complex with GpppG and S-Adenosyl-L-homocysteine

PDB Compounds: (A:) type II methyltransferase

SCOP Domain Sequences for d2p3qa1:

Sequence; same for both SEQRES and ATOM records:

>d2p3qa1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]}
tlgekwksrlnalgksefqiykksgiqevdrtlakegikrgetdhhavsrgsaklrwfve
rnlvtpegkvvdlgcgrggwsyycgglknvrevkgltkggpgheepipmstygwnlvrlq
sgvdvffippercdtllcdigesspnptveagrtlrvlnlvenwlsnntqfcvkvlnpym
ssviekmealqrkhggalvrnplsrnsthemywvsnasgnivssvnmisrmlinrftmrh
kkatyepdvdlgsgtrn

Timeline for d2p3qa1:

• d2p3qa1 is new in SCOP 1.75
  
• d2p3qa1 appears in SCOPe 2.01
  
• d2p3qa1 appears in the current release, SCOPe 2.08, called d2p3qa_