![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) ![]() |
![]() | Family c.66.1.48: Nsp15 N-terminal domain-like [142625] (2 proteins) rudiment methyltransferase fold that probably has lost the enzymatic activity; contains extra N-terminal alpha+beta subdomain |
![]() | Protein Nsp15 [142626] (2 species) |
![]() | Species SARS coronavirus [TaxId:227859] [142628] (3 PDB entries) Uniprot Q6VA80 6619-6774 |
![]() | Domain d2ozkb1: 2ozk B:28-190 [149109] Other proteins in same PDB: d2ozka2, d2ozkb2, d2ozkc2, d2ozkd2 automated match to d2ozka1 |
PDB Entry: 2ozk (more details), 2.9 Å
SCOPe Domain Sequences for d2ozkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ozkb1 c.66.1.48 (B:28-190) Nsp15 {SARS coronavirus [TaxId: 227859]} nnavytkvdgidveifenkttlpvnvafelwakrnikpvpeikilnnlgvdiaantviwd ykreapahvstigvctmtdiakkptesacssltvlfdgrvegqvdlfrnarngvlitegs vkgltpskgpaqasvngvtligesvktqfnyfkkvdgiiqqlp
Timeline for d2ozkb1: