Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (8 families) less regular structure consisting of variable repeats |
Family c.10.2.1: Internalin LRR domain [52059] (3 proteins) capped at the N-end with a truncated EF-hand subdomain this is a repeat family; one repeat unit is 2omx A:261-239 found in domain |
Protein Internalin B [52060] (1 species) |
Species Listeria monocytogenes [TaxId:1639] [52061] (9 PDB entries) |
Domain d2omua2: 2omu A:37-235 [148883] Other proteins in same PDB: d2omua1, d2omub1 automatically matched to d1h6ta2 complexed with ca, cl; mutant |
PDB Entry: 2omu (more details), 1.8 Å
SCOP Domain Sequences for d2omua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2omua2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} titqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgvey lnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqitd idplknltnlnrlelssntisdisalsgltslqqlsfssnqvtdlkplanlttlerldis snkvsdisvlakltnlesl
Timeline for d2omua2: