SCOP 1.75: Domain d2omua2: 2omu A:37-235

Lineage for d2omua2 (2omu A:37-235)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (8 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.1: Internalin LRR domain [52059] (3 proteins)
   capped at the N-end with a truncated EF-hand subdomain
   this is a repeat family; one repeat unit is 2omx A:261-239 found in domain

6. Protein Internalin B [52060] (1 species)

7. Species Listeria monocytogenes [TaxId:1639] [52061] (9 PDB entries)

8. Domain d2omua2: 2omu A:37-235 [148883]
   Other proteins in same PDB: d2omua1, d2omub1
   automatically matched to d1h6ta2
   complexed with ca, cl; mutant

Details for d2omua2

PDB Entry: 2omu, 1.8 Å

PDB Description: crystal structure of inla g194s+s y369s/hec1 complex

PDB Compounds: (A:) Internalin-A

SCOP Domain Sequences for d2omua2:

Sequence; same for both SEQRES and ATOM records:

>d2omua2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}
titqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgvey
lnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqitd
idplknltnlnrlelssntisdisalsgltslqqlsfssnqvtdlkplanlttlerldis
snkvsdisvlakltnlesl

Timeline for d2omua2:

• d2omua2 is new in SCOP 1.75
  
• d2omua2 appears in SCOPe 2.01
  
• d2omua2 last appears in SCOPe 2.03