![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.2: L domain-like [52058] (8 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.1: Internalin LRR domain [52059] (3 proteins) capped at the N-end with a truncated EF-hand subdomain this is a repeat family; one repeat unit is 2omx A:261-239 found in domain |
![]() | Protein Internalin B [52060] (1 species) |
![]() | Species Listeria monocytogenes [TaxId:1639] [52061] (9 PDB entries) |
![]() | Domain d1h6ta2: 1h6t A:31-240 [65687] Other proteins in same PDB: d1h6ta1 |
PDB Entry: 1h6t (more details), 1.6 Å
SCOP Domain Sequences for d1h6ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} gplgsetitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiks vqgiqylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslsle hngisdinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltkl qnlylsknhisdlralaglknldvlelfsq
Timeline for d1h6ta2: