SCOPe 2.03: Domain d2omta2: 2omt A:37-235

Lineage for d2omta2 (2omt A:37-235)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.1: Internalin LRR domain [52059] (4 proteins)
   capped at the N-end with a truncated EF-hand subdomain
   this is a repeat family; one repeat unit is 2omx A:261-239 found in domain

6. Protein Internalin A [82324] (1 species)

7. Species Listeria monocytogenes [TaxId:1639] [82325] (10 PDB entries)

8. Domain d2omta2: 2omt A:37-235 [148880]
   Other proteins in same PDB: d2omta1, d2omtb_
   automatically matched to d1h6ta2
   complexed with ca, cl

Details for d2omta2

PDB Entry: 2omt, 2 Å

PDB Description: crystal structure of inla g194s+s/hec1 complex

PDB Compounds: (A:) Internalin-A

SCOPe Domain Sequences for d2omta2:

Sequence; same for both SEQRES and ATOM records:

>d2omta2 c.10.2.1 (A:37-235) Internalin A {Listeria monocytogenes [TaxId: 1639]}
titqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgvey
lnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqitd
idplknltnlnrlelssntisdisalsgltslqqlsfssnqvtdlkplanlttlerldis
snkvsdisvlakltnlesl

Timeline for d2omta2:

• d2omta2 first appeared in SCOP 1.75
  
• d2omta2 appears in SCOPe 2.02
  
• d2omta2 does not appear in SCOPe 2.04