Lineage for d2omta1 (2omt A:418-497)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375843Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins)
    truncated fold fused to an LRR domain
  6. 2375844Protein Internalin A [81973] (1 species)
  7. 2375845Species Listeria monocytogenes [TaxId:1639] [81974] (10 PDB entries)
  8. 2375851Domain d2omta1: 2omt A:418-497 [148879]
    Other proteins in same PDB: d2omta3, d2omtb2, d2omtb3
    automated match to d2omza1
    complexed with ca, cl

Details for d2omta1

PDB Entry: 2omt (more details), 2 Å

PDB Description: crystal structure of inla g194s+s/hec1 complex
PDB Compounds: (A:) Internalin-A

SCOPe Domain Sequences for d2omta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omta1 b.1.18.15 (A:418-497) Internalin A {Listeria monocytogenes [TaxId: 1639]}
wtnapvnykanvsipntvknvtgaliapatisdggsytepditwnlpsytnevsytfsqp
vtigkgtttfsgtvtqplka

SCOPe Domain Coordinates for d2omta1:

Click to download the PDB-style file with coordinates for d2omta1.
(The format of our PDB-style files is described here.)

Timeline for d2omta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2omta3