SCOPe 2.07: Domain d2oi8a1: 2oi8 A:8-86

Lineage for d2oi8a1 (2oi8 A:8-86)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Putative regulatory protein Sco4313 [158254] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [158255] (1 PDB entry)
   Uniprot Q9KXS8 8-86

8. Domain d2oi8a1: 2oi8 A:8-86 [148778]
   Other proteins in same PDB: d2oi8a2

Details for d2oi8a1

PDB Entry: 2oi8, 2.5 Å

PDB Description: Crystal structure of putative regulatory protein SCO4313

PDB Compounds: (A:) Putative regulatory protein SCO4313

SCOPe Domain Sequences for d2oi8a1:

Sequence; same for both SEQRES and ATOM records:

>d2oi8a1 a.4.1.9 (A:8-86) Putative regulatory protein Sco4313 {Streptomyces coelicolor [TaxId: 1902]}
tpreryrtqvraeikdhaweqiatagasalslnaiakrmgmsgpalyryfdgrdelitel
irdayrsqadslraaaasg

Timeline for d2oi8a1:

• d2oi8a1 first appeared in SCOP 1.75
  
• d2oi8a1 appears in SCOPe 2.06
  
• d2oi8a1 appears in the current release, SCOPe 2.08