SCOPe 2.03: Domain d2ogka1: 2ogk A:4-144

Lineage for d2ogka1 (2ogk A:4-144)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.77: RL5-like [55281] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654

4. Superfamily d.77.1: RL5-like [55282] (3 families)

5. Family d.77.1.2: SSO1042-like [160489] (5 proteins)
   Pfam PF01877; DUF54

6. Protein Hypothetical protein AF2318 [160492] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [160493] (1 PDB entry)
   Uniprot O27966 3-143

8. Domain d2ogka1: 2ogk A:4-144 [148767]

Details for d2ogka1

PDB Entry: 2ogk, 3 Å

PDB Description: crystal structure of protein af2318 from archaeglobus fulgidus, pfam duf54

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2ogka1:

Sequence, based on SEQRES records:

>d2ogka1 d.77.1.2 (A:4-144) Hypothetical protein AF2318 {Archaeoglobus fulgidus [TaxId: 2234]}
gkiewvrvsavvhstedrekvgeaistlfpfefeiavskakghygnpmeyleveltksse
ikkfwknllellgeqaeeilstledrideqnvlhiridkqkaylgevsltsggdpiavkl
rlvtypskrekviefarelct

Sequence, based on observed residues (ATOM records):

>d2ogka1 d.77.1.2 (A:4-144) Hypothetical protein AF2318 {Archaeoglobus fulgidus [TaxId: 2234]}
gkiewvrvsavvhstedrekvgeaistlfpfefeiavskmeyleveltksseikkfwknl
lellgeqaeeilstledrideqnvlhiridkqkaylgevsltsggdpiavklrlvtypsk
rekviefarelct

Timeline for d2ogka1:

• d2ogka1 first appeared in SCOP 1.75
  
• d2ogka1 appears in SCOPe 2.02
  
• d2ogka1 appears in SCOPe 2.04
  
• d2ogka1 appears in the current release, SCOPe 2.08